AnaSpec Introduces Ninety-Seven New Catalog Peptides

Released on: March 6, 2008, 1:49 pm

Press Release Author: AnaSpec Inc.

Industry: Biotech

Press Release Summary: This week AnaSpec, one of the world's largest providers of
custom and catalog peptides, introduced ninety-seven (97) new catalog peptides.

Press Release Body: March 6, 2008 - San Jose, CA

This week AnaSpec, one of the world's largest providers of custom and catalog
peptides, introduced ninety-seven (97) new catalog peptides.

[NMeG24; NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22-27)- Cat# 61937
This amino acids 22 to 27 fragment is a modification of the human islet amyloid
polypeptide hIAPP (NFGAIL) with N-methylation of the amide bonds at G24 and I26. The
introduction of two N-methyl rests in the amyloid-core-containing sequence NFGAIL
converts this amyloidogenic and cytotoxic sequence into non-amyloidogenic and
non-cytotoxic peptide. The peptide is able to bind with high-affinity full-length
hIAPP and to inhibit its fibrillogenesis.
Sequence: NF-(NMe-G)-A-(NMe-I)-L

[Ala20]-beta-Amyloid (1-42)- Cat# 62446
This is a modified beta-Amyloid (1-42); with Phe20 replaced by Ala20.
Sequence: DAEFRHDSGYEVHHQKLVFAAEDVGSNKGAIIGLMVGGVVIA

[Cys40]-beta-hairpin (BHA); Protein G B1 Domain (41-56)- Cat# 62533
This ?-hairpin (BHA) peptide is amino acid residues 41 to 56 fragment from the B1
domain of protein G. BHA peptide adopts a stable ?-hairpin structure in aqueous
solution with a population of 40%. In water; BHA adopts a twisted conformation
around the peptide axis. In 30% (vol/vol) TFE/water solution; the ?-hairpin
population further increases up to

Web Site: http://www.anaspec.com

Contact Details: AnaSpec Inc.
2149 O\'Toole Ave.
San Jose, CA 95131
1-408-452-5055 (Tel)
1-408-452-5059 (Fax)
1-800-452-5530
ping@anaspec.com
www.anaspec.com

  • Printer Friendly Format
  • Back to previous page...
  • Back to home page...
  • Submit your press releases...
  •